Recombinant Human Terminal nucleotidyltransferase 4B (TENT4B), Unconjugated, E. coli

Artikelnummer: BIM-RPC26068
Artikelname: Recombinant Human Terminal nucleotidyltransferase 4B (TENT4B), Unconjugated, E. coli
Artikelnummer: BIM-RPC26068
Hersteller Artikelnummer: RPC26068
Alternativnummer: BIM-RPC26068-20UG,BIM-RPC26068-100UG,BIM-RPC26068-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: PAP-associated domain-containing protein 5 (Terminal nucleotidyltransferase 4B, Terminal uridylyltransferase 3, TUTase 3, Topoisomerase-related function protein 4-2, TRF4-2, GLD4, PAPD5, TRF4-2)
Recombinant Human Terminal nucleotidyltransferase 4B (TENT4B) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: TENT4B. Target Synonyms: PAP-associated domain-containing protein 5 (Terminal nucleotidyltransferase 4B, Terminal uridylyltransferase 3, TUTase 3, Topoisomerase-related function protein 4-2, TRF4-2, GLD4, PAPD5, TRF4-2). Accession Number: Q8NDF8. Expression Region: 1~572aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 67.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 67.3kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: MYRSGERLLGSHALPAEQRDFLPLETTNNNNNHHQPGAWARRAGSSASSPPSASSSPHPSAAVPAADPADSASGSSNKRKRDNKASGGRAAGGGRADGGGVVYSGTPWKRRNYNQGVVGLHEEISDFYEYMSPRPEEEKMRMEVVNRIESVIKELWPSADVQIFGSFKTGLYLPTSDIDLVVFGKWENLPLWTLEEALRKHKVADEDSVKVLDKATVPIIKLTDSFTEVKVDISFNVQNGVRAADLIKDFTKKYP
Target-Kategorie: TENT4B