Recombinant Mouse Interleukin-31 receptor subunit alpha (Il31ra), partial, Unconjugated, E. coli

Artikelnummer: BIM-RPC26015
Artikelname: Recombinant Mouse Interleukin-31 receptor subunit alpha (Il31ra), partial, Unconjugated, E. coli
Artikelnummer: BIM-RPC26015
Hersteller Artikelnummer: RPC26015
Alternativnummer: BIM-RPC26015-20UG,BIM-RPC26015-100UG,BIM-RPC26015-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Mouse
Konjugation: Unconjugated
Alternative Synonym: GLM-R (mGLM-R, Gp130-like monocyte receptor, Gp130-like receptor, Novel cytokine receptor 10, NR10, ZcytoR17, Glmr)
Recombinant Mouse Interleukin-31 receptor subunit alpha (Il31ra), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Il31ra. Target Synonyms: GLM-R (mGLM-R, Gp130-like monocyte receptor, Gp130-like receptor, Novel cytokine receptor 10, NR10, ZcytoR17, Glmr). Accession Number: Q8K5B1. Expression Region: 19~499aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 59.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 59.2kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: VLPTKPENISCVFYFDRNLTCTWRPEKETNDTSYIVTLTYSYGKSNYSDNATEASYSFPRSCAMPPDICSVEVQAQNGDGKVKSDITYWHLISIAKTEPPIILSVNPICNRMFQIQWKPREKTRGFPLVCMLRFRTVNSSHWTEVNFENCKQVCNLTGLQAFTEYVLALRFRFNDSRYWSKWSKEETRVTMEEVPHVLDLWRILEPADMNGDRKVRLLWKKARGAPVLEKTFGYHIQYFAENSTNLTEINNITTQ
Target-Kategorie: Il31ra