Recombinant Pig Saposin-B-Val (PSAP), Unconjugated, Yeast

Artikelnummer: BIM-RPC25994
Artikelname: Recombinant Pig Saposin-B-Val (PSAP), Unconjugated, Yeast
Artikelnummer: BIM-RPC25994
Hersteller Artikelnummer: RPC25994
Alternativnummer: BIM-RPC25994-20UG,BIM-RPC25994-100UG,BIM-RPC25994-1MG
Hersteller: Biomatik Corporation
Wirt: Yeast
Kategorie: Proteine/Peptide
Spezies Reaktivität: Porcine
Konjugation: Unconjugated
Alternative Synonym: Cerebroside sulfate activator (CS-ACT, Non-specific activator, Sphingolipid activator protein 1, SAP-1)
Recombinant Pig Saposin-B-Val (PSAP) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Pig (Sus scrofa, Porcine). Target Name: PSAP. Target Synonyms: Cerebroside sulfate activator (CS-ACT, Non-specific activator, Sphingolipid activator protein 1, SAP-1). Accession Number: P81405. Expression Region: 1~80aa. Tag Info: N-Terminal 6Xhis-Flag-Tagged. Theoretical MW: 11.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 11.9kDa
Tag: N-Terminal 6Xhis-Flag-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: GDVCQDCIQMVTDLQNAVRTNSTFVEALVNHAKEECDRLGPGMADMCKNYISQYSEIAIQMMMHMQPKDICGLVGFCEEV
Target-Kategorie: PSAP