Recombinant Measles virus Nucleoprotein (N), partial, Unconjugated, E. coli

Artikelnummer: BIM-RPC25937
Artikelname: Recombinant Measles virus Nucleoprotein (N), partial, Unconjugated, E. coli
Artikelnummer: BIM-RPC25937
Hersteller Artikelnummer: RPC25937
Alternativnummer: BIM-RPC25937-20UG,BIM-RPC25937-100UG,BIM-RPC25937-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Virus
Konjugation: Unconjugated
Alternative Synonym: Nucleocapsid proteinNPProtein N
Recombinant Measles virus Nucleoprotein (N), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Measles virus (strain Edmonston-Schwarz vaccine) (MeV) (Subacute sclerose panencephalitis virus). Target Name: N. Target Synonyms: Nucleocapsid proteinNPProtein N. Accession Number: B8PZP3. Expression Region: 1~400aa. Tag Info: N-Terminal 10Xhis-Tagged. Theoretical MW: 49.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 49.9kDa
Tag: N-Terminal 10Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: MATLLRSLALFKRNKDKPPITSGSGGAIRGIKHIIIVPIPGDSSITTRSRLLDRLVRLIGNPDVSGPKLTGALIGILSLFVESPGQLIQRITDDPDVSIRLLEVVQSDQSQSGLTFASRGTNMEDEADQYFSHDDPISSDQSRFGWFGNKEISDIEVQDPEGFNMILGTILAQIWVLLAKAVTAPDTAADSELRRWIKYTQQRRVVGEFRLERKWLDVVRNRIAEDLSLRRFMVALILDIKRTPGNKPRIAEMIC
Target-Kategorie: N