Recombinant Human Activin receptor type-2B (ACVR2B), partial, Unconjugated, E. coli

Artikelnummer: BIM-RPC25928
Artikelname: Recombinant Human Activin receptor type-2B (ACVR2B), partial, Unconjugated, E. coli
Artikelnummer: BIM-RPC25928
Hersteller Artikelnummer: RPC25928
Alternativnummer: BIM-RPC25928-20UG,BIM-RPC25928-100UG,BIM-RPC25928-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Activin receptor type IIBACTR-IIB
Recombinant Human Activin receptor type-2B (ACVR2B), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: ACVR2B. Target Synonyms: Activin receptor type IIBACTR-IIB. Accession Number: Q13705. Expression Region: 19~137aa. Tag Info: N-Terminal 6Xhis-B2M-Tagged. Theoretical MW: 27.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 27.7kDa
Tag: N-Terminal 6Xhis-B2M-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: SGRGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEAGGPEVTYEPPPTAPTLLT
Target-Kategorie: ACVR2B