Recombinant Human Transcription activator BRG1 (SMARCA4), partial, Unconjugated, E. coli

Artikelnummer: BIM-RPC25894
Artikelname: Recombinant Human Transcription activator BRG1 (SMARCA4), partial, Unconjugated, E. coli
Artikelnummer: BIM-RPC25894
Hersteller Artikelnummer: RPC25894
Alternativnummer: BIM-RPC25894-20UG,BIM-RPC25894-100UG,BIM-RPC25894-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: ATP-dependent helicase SMARCA4BRG1-associated factor 190ABAF190AMitotic growth and transcription activatorProtein BRG-1Protein brahma homolog 1SNF2-betaSWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 4
Recombinant Human Transcription activator BRG1 (SMARCA4), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: SMARCA4. Target Synonyms: ATP-dependent helicase SMARCA4BRG1-associated factor 190ABAF190AMitotic growth and transcription activatorProtein BRG-1Protein brahma homolog 1SNF2-betaSWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 4. Accession Number: P51532. Expression Region: 808~1092aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 37.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 37.1kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: IIVPLSTLSNWAYEFDKWAPSVVKVSYKGSPAARRAFVPQLRSGKFNVLLTTYEYIIKDKHILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRLLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGEKVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVIKCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEH
Target-Kategorie: SMARCA4