Recombinant Human 40S ribosomal protein S3 (RPS3), Unconjugated, E. coli

Artikelnummer: BIM-RPC25889
Artikelname: Recombinant Human 40S ribosomal protein S3 (RPS3), Unconjugated, E. coli
Artikelnummer: BIM-RPC25889
Hersteller Artikelnummer: RPC25889
Alternativnummer: BIM-RPC25889-20UG,BIM-RPC25889-100UG,BIM-RPC25889-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: 40S ribosomal protein S3, fb13d09, FLJ26283, FLJ27450, IMR 90 ribosomal protein S3, MGC56088, MGC87870, OTTHUMP00000229804, OTTHUMP00000229805, OTTHUMP00000229874, OTTHUMP00000229877, OTTHUMP00000229878, OTTHUMP00000229879, OTTHUMP00000229880, OTTHUMP00000229882, OTTHUMP00000229883, OTTHUMP00000229886, Ribosomal protein S3, rps3, RS3_HUMAN, S3, wu:fb13d09, zgc:56088
Recombinant Human 40S ribosomal protein S3 (RPS3) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: RPS3. Target Synonyms: 40S ribosomal protein S3, fb13d09, FLJ26283, FLJ27450, IMR 90 ribosomal protein S3, MGC56088, MGC87870, OTTHUMP00000229804, OTTHUMP00000229805, OTTHUMP00000229874, OTTHUMP00000229877, OTTHUMP00000229878. Accession Number: P23396. Expression Region: 2~243aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 42.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 42.6kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: AVQISKKRKFVADGIFKAELNEFLTRELAEDGYSGVEVRVTPTRTEIIILATRTQNVLGEKGRRIRELTAVVQKRFGFPEGSVELYAEKVATRGLCAIAQAESLRYKLLGGLAVRRACYGVLRFIMESGAKGCEVVVSGKLRGQRAKSMKFVDGLMIHSGDPVNYYVDTAVRHVLLRQGVLGIKVKIMLPWDPTGKIGPKKPLPDHVSIVEPKDEILPTTPISEQKGGKPEPPAMPQPVPTA
Target-Kategorie: RPS3