Recombinant Human Collagen alpha-1 (XVII) chain (COL17A1), partial, Unconjugated, E. coli

Artikelnummer: BIM-RPC25880
Artikelname: Recombinant Human Collagen alpha-1 (XVII) chain (COL17A1), partial, Unconjugated, E. coli
Artikelnummer: BIM-RPC25880
Hersteller Artikelnummer: RPC25880
Alternativnummer: BIM-RPC25880-20UG,BIM-RPC25880-100UG,BIM-RPC25880-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: 180 kDa bullous pemphigoid antigen 2Bullous pemphigoid antigen 2
Recombinant Human Collagen alpha-1 (XVII) chain (COL17A1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: COL17A1. Target Synonyms: 180 kDa bullous pemphigoid antigen 2Bullous pemphigoid antigen 2. Accession Number: Q9UMD9. Expression Region: 1253~1497aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 28.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 28.4kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: YLTSPDVRSFIVGPPGPPGPQGPPGDSRLLSTDASHSRGSSSSSHSSSVRRGSSYSSSMSTGGGGAGSLGAGGAFGEAAGDRGPYGTDIGPGGGYGAAAEGGMYAGNGGLLGADFAGDLDYNELAVRVSESMQRQGLLQGMAYTVQGPPGQPGPQGPPGISKVFSAYSNVTADLMDFFQTYGAIQGPPGQKGEMGTPGPKGDRGPAGPPGHPGPPGPRGHKGEKGDKGDQVYAGRRRRRSIAVKP
Target-Kategorie: COL17A1