Recombinant Human Cyclin-dependent kinase 4 (CDK4), Unconjugated, E. coli

Artikelnummer: BIM-RPC25870
Artikelname: Recombinant Human Cyclin-dependent kinase 4 (CDK4), Unconjugated, E. coli
Artikelnummer: BIM-RPC25870
Hersteller Artikelnummer: RPC25870
Alternativnummer: BIM-RPC25870-20UG,BIM-RPC25870-100UG,BIM-RPC25870-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Cell division protein kinase 4PSK-J3
Recombinant Human Cyclin-dependent kinase 4 (CDK4) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: CDK4. Target Synonyms: Cell division protein kinase 4PSK-J3. Accession Number: P11802. Expression Region: 2~303aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 37.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 37.6kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: ATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGGGGGLPISTVREVALLRRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDLMRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRP
Target-Kategorie: CDK4