Recombinant Human Growth/differentiation factor 15 (GDF15), partial, Unconjugated, E. coli

Artikelnummer: BIM-RPC25862
Artikelname: Recombinant Human Growth/differentiation factor 15 (GDF15), partial, Unconjugated, E. coli
Artikelnummer: BIM-RPC25862
Hersteller Artikelnummer: RPC25862
Alternativnummer: BIM-RPC25862-20UG,BIM-RPC25862-100UG,BIM-RPC25862-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Macrophage inhibitory cytokine 1, MIC-1NSAID-activated gene 1 protein, NAG-1NSAID-regulated gene 1 protein, NRG-1, Placental TGF-betaPlacental bone morphogenetic protein, Prostate differentiation factor
Recombinant Human Growth/differentiation factor 15 (GDF15), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: GDF15. Target Synonyms: Macrophage inhibitory cytokine 1, MIC-1NSAID-activated gene 1 protein, NAG-1NSAID-regulated gene 1 protein, NRG-1, Placental TGF-betaPlacental bone morphogenetic protein, Prostate differentiation factor. Accession Number: Q99988. Expression Region: 198~308aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 16.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 16.2kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: RNGDHCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDLLAKDCHCI
Target-Kategorie: GDF15