Recombinant Human ADP-ribosylation factor-like protein 2-binding protein (ARL2BP), Unconjugated, E. coli

Artikelnummer: BIM-RPC25849
Artikelname: Recombinant Human ADP-ribosylation factor-like protein 2-binding protein (ARL2BP), Unconjugated, E. coli
Artikelnummer: BIM-RPC25849
Hersteller Artikelnummer: RPC25849
Alternativnummer: BIM-RPC25849-20UG,BIM-RPC25849-100UG,BIM-RPC25849-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Binder of ARF2 protein 1
Recombinant Human ADP-ribosylation factor-like protein 2-binding protein (ARL2BP) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: ARL2BP. Target Synonyms: Binder of ARF2 protein 1. Accession Number: Q9Y2Y0. Expression Region: 1~163aa. Tag Info: N-Terminal Gst-Tagged. Theoretical MW: 45.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 45.8kDa
Tag: N-Terminal Gst-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: MDALEGESFALSFSSASDAEFDAVVGYLEDIIMDDEFQLLQRNFMDKYYLEFEDTEENKLIYTPIFNEYISLVEKYIEEQLLQRIPEFNMAAFTTTLQHHKDEVAGDIFDMLLTFTDFLAFKEMFLDYRAEKEGRGLDLSSGLVVTSLCKSSSLPASQNNLRH
Target-Kategorie: ARL2BP