Recombinant Rat Anionic trypsin-1 (Prss1), Unconjugated, E. coli

Artikelnummer: BIM-RPC25814
Artikelname: Recombinant Rat Anionic trypsin-1 (Prss1), Unconjugated, E. coli
Artikelnummer: BIM-RPC25814
Hersteller Artikelnummer: RPC25814
Alternativnummer: BIM-RPC25814-20UG,BIM-RPC25814-100UG,BIM-RPC25814-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Rat
Konjugation: Unconjugated
Alternative Synonym: Anionic trypsin I (Pretrypsinogen I, Serine protease 1, Try1)
Recombinant Rat Anionic trypsin-1 (Prss1) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Rat (Rattus norvegicus). Target Name: Prss1. Target Synonyms: Anionic trypsin I (Pretrypsinogen I, Serine protease 1, Try1). Accession Number: P00762. Expression Region: 24~246aa. Tag Info: N-Terminal 10Xhis-Tagged. Theoretical MW: 27.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 27.2kDa
Tag: N-Terminal 10Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: IVGGYTCPEHSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGDEQFINAAKIIKHPNYSSWTLNNDIMLIKLSSPVKLNARVAPVALPSACAPAGTQCLISGWGNTLSNGVNNPDLLQCVDAPVLSQADCEAAYPGEITSSMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCALPDNPGVYTKVCNFVGWIQDTIAAN
Target-Kategorie: Prss1