Recombinant Human DNA-binding protein Ikaros (IKZF1), Unconjugated, E. coli

Artikelnummer: BIM-RPC25804
Artikelname: Recombinant Human DNA-binding protein Ikaros (IKZF1), Unconjugated, E. coli
Artikelnummer: BIM-RPC25804
Hersteller Artikelnummer: RPC25804
Alternativnummer: BIM-RPC25804-20UG,BIM-RPC25804-100UG,BIM-RPC25804-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Ikaros family zinc finger protein 1 (Lymphoid transcription factor LyF-1, IK1, IKAROS, LYF1, ZNFN1A1)
Recombinant Human DNA-binding protein Ikaros (IKZF1) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: IKZF1. Target Synonyms: Ikaros family zinc finger protein 1 (Lymphoid transcription factor LyF-1, IK1, IKAROS, LYF1, ZNFN1A1). Accession Number: Q13422. Expression Region: 1~477aa. Tag Info: N-Terminal 6Xhis-Avi-Tagged. Theoretical MW: 56.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 56.8kDa
Tag: N-Terminal 6Xhis-Avi-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: MDADEGQDMSQVSGKESPPVSDTPDEGDEPMPIPEDLSTTSGGQQSSKSDRVVASNVKVETQSDEENGRACEMNGEECAEDLRMLDASGEKMNGSHRDQGSSALSGVGGIRLPNGKLKCDICGIICIGPNVLMVHKRSHTGERPFQCNQCGASFTQKGNLLRHIKLHSGEKPFKCHLCNYACRRRDALTGHLRTHSVIKEETNHSEMAEDLCKIGSERSLVLDRLASNVAKRKSSMPQKFLGDKGLSDTPYDSSA
Target-Kategorie: IKZF1