Recombinant Mouse Secretoglobin family 1C member 1 (Scgb1c1), Unconjugated, E. coli

Artikelnummer: BIM-RPC25796
Artikelname: Recombinant Mouse Secretoglobin family 1C member 1 (Scgb1c1), Unconjugated, E. coli
Artikelnummer: BIM-RPC25796
Hersteller Artikelnummer: RPC25796
Alternativnummer: BIM-RPC25796-20UG,BIM-RPC25796-100UG,BIM-RPC25796-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Mouse
Konjugation: Unconjugated
Alternative Synonym: Secretoglobin RYD5 (Ryd5)
Recombinant Mouse Secretoglobin family 1C member 1 (Scgb1c1) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Scgb1c1. Target Synonyms: Secretoglobin RYD5 (Ryd5). Accession Number: Q7M742. Expression Region: 24~95aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 21.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 21.2kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: EDDNEFFMEFLQTLLVGTPEELYEGPLGKYNVNDMAKSALRELKSCIDELQPVHKEQLVKLLVQVLDAQEDT
Target-Kategorie: Scgb1c1