Recombinant Human Apolipoprotein B-100 (APOB), partial, Unconjugated, E. coli

Artikelnummer: BIM-RPC25785
Artikelname: Recombinant Human Apolipoprotein B-100 (APOB), partial, Unconjugated, E. coli
Artikelnummer: BIM-RPC25785
Hersteller Artikelnummer: RPC25785
Alternativnummer: BIM-RPC25785-20UG,BIM-RPC25785-100UG,BIM-RPC25785-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Apo B-100 (Apo B-48)
Recombinant Human Apolipoprotein B-100 (APOB), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: APOB. Target Synonyms: Apo B-100 (Apo B-48). Accession Number: P04114. Expression Region: 28~127aa. Tag Info: N-Terminal 10Xhis-Tagged. Theoretical MW: 14.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 14.7kDa
Tag: N-Terminal 10Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: EEEMLENVSLVCPKDATRFKHLRKYTYNYEAESSSGVPGTADSRSATRINCKVELEVPQLCSFILKTSQCTLKEVYGFNPEGKALLKKTKNSEEFAAAMS
Target-Kategorie: APOB