Recombinant E. coli O6:H1 Propionate kinase (tdcD), Unconjugated

Artikelnummer: BIM-RPC25780
Artikelname: Recombinant E. coli O6:H1 Propionate kinase (tdcD), Unconjugated
Artikelnummer: BIM-RPC25780
Hersteller Artikelnummer: RPC25780
Alternativnummer: BIM-RPC25780-20UG,BIM-RPC25780-100UG,BIM-RPC25780-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: E. coli
Konjugation: Unconjugated
Alternative Synonym: tdcD, c3873, Propionate kinase, EC 2.7.2.15
Recombinant E. coli O6:H1 Propionate kinase (tdcD) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: E. coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC). Target Name: tdcD. Target Synonyms: tdcD, c3873, Propionate kinase, EC 2.7.2.15. Accession Number: P59244. Expression Region: 1~402aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 50.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 50.4kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: MNEFPVVLVINCGSSSIKFSVLNASDCEVLMSGIADGINSENAFLSVNGGEPAPLAHHSYEGALKAIAFELEKRNLNDNVALIGHRIAHGGSIFTESAIITDEVIDNIRRVSPLAPLHNYANLSGIESAQQLFPGVTQVAVFDTSFHQTMAPEAYLYGLPWKYYEELGVRRYGFHGTSHRYVSQRAHSLLNLAEDDSGLVVAHLGNGASICAVRNGQSVDTSMGMTPLEGLMMGTRSGDVDFGAMSWVASQTNQS
Target-Kategorie: tdcD