Recombinant Human Ras GTPase-activating protein SynGAP (SYNGAP1), partial, Unconjugated, E. coli

Artikelnummer: BIM-RPC25777
Artikelname: Recombinant Human Ras GTPase-activating protein SynGAP (SYNGAP1), partial, Unconjugated, E. coli
Artikelnummer: BIM-RPC25777
Hersteller Artikelnummer: RPC25777
Alternativnummer: BIM-RPC25777-20UG,BIM-RPC25777-100UG,BIM-RPC25777-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Neuronal RasGAP (Synaptic Ras GTPase-activating protein 1, Synaptic Ras-GAP 1, KIAA1938)
Recombinant Human Ras GTPase-activating protein SynGAP (SYNGAP1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: SYNGAP1. Target Synonyms: Neuronal RasGAP (Synaptic Ras GTPase-activating protein 1, Synaptic Ras-GAP 1, KIAA1938). Accession Number: Q96PV0. Expression Region: 1161~1343aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 25.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 25.5kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: MPHLSADIESAHIEREEYKLKEYSKSMDESRLDRVKEYEEEIHSLKERLHMSNRKLEEYERRLLSQEEQTSKILMQYQARLEQSEKRLRQQQAEKDSQIKSIIGRLMLVEEELRRDHPAMAEPLPEPKKRLLDAQERQLPPLGPTNPRVTLAPPWNGLAPPAPPPPPRLQITENGEFRNTADH
Target-Kategorie: SYNGAP1