Recombinant E. coli Outer membrane porin F (ompF), Unconjugated

Artikelnummer: BIM-RPC25741
Artikelname: Recombinant E. coli Outer membrane porin F (ompF), Unconjugated
Artikelnummer: BIM-RPC25741
Hersteller Artikelnummer: RPC25741
Alternativnummer: BIM-RPC25741-20UG,BIM-RPC25741-100UG,BIM-RPC25741-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: E. coli
Konjugation: Unconjugated
Alternative Synonym: Outer membrane protein 1A (Outer membrane protein B, Outer membrane protein IA, Porin OmpF, cmlB, coa, cry, tolF)
Recombinant E. coli Outer membrane porin F (ompF) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: E. coli (strain K12). Target Name: ompF. Target Synonyms: Outer membrane protein 1A (Outer membrane protein B, Outer membrane protein IA, Porin OmpF, cmlB, coa, cry, tolF). Accession Number: P02931. Expression Region: 23~362aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 44.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 44.1kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: AEIYNKDGNKVDLYGKAVGLHYFSKGNGENSYGGNGDMTYARLGFKGETQINSDLTGYGQWEYNFQGNNSEGADAQTGNKTRLAFAGLKYADVGSFDYGRNYGVVYDALGYTDMLPEFGGDTAYSDDFFVGRVGGVATYRNSNFFGLVDGLNFAVQYLGKNERDTARRSNGDGVGGSISYEYEGFGIVGAYGAADRTNLQEAQPLGNGKKAEQWATGLKYDANNIYLAANYGETRNATPITNKFTNTSGFANKTQ
Target-Kategorie: ompF