Recombinant Rat Acyl-CoA-binding protein (Dbi), Unconjugated, E. coli

Artikelnummer: BIM-RPC25728
Artikelname: Recombinant Rat Acyl-CoA-binding protein (Dbi), Unconjugated, E. coli
Artikelnummer: BIM-RPC25728
Hersteller Artikelnummer: RPC25728
Alternativnummer: BIM-RPC25728-20UG,BIM-RPC25728-100UG,BIM-RPC25728-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Rat
Konjugation: Unconjugated
Alternative Synonym: Diazepam-binding inhibitor
Recombinant Rat Acyl-CoA-binding protein (Dbi) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Rat (Rattus norvegicus). Target Name: Dbi. Target Synonyms: Diazepam-binding inhibitor. Accession Number: P11030. Expression Region: 2~87aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 16.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 16.9kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: SQADFDKAAEEVKRLKTQPTDEEMLFIYSHFKQATVGDVNTDRPGLLDLKGKAKWDSWNKLKGTSKENAMKTYVEKVEELKKKYGI
Target-Kategorie: Dbi