Recombinant Danio rerio Hydroxylysine kinase (hykk), Unconjugated, E. coli

Artikelnummer: BIM-RPC25696
Artikelname: Recombinant Danio rerio Hydroxylysine kinase (hykk), Unconjugated, E. coli
Artikelnummer: BIM-RPC25696
Hersteller Artikelnummer: RPC25696
Alternativnummer: BIM-RPC25696-20UG,BIM-RPC25696-100UG,BIM-RPC25696-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Zebrafish
Konjugation: Unconjugated
Alternative Synonym: agphd1
Recombinant Danio rerio Hydroxylysine kinase (hykk) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Danio rerio (Zebrafish) (Brachydanio rerio). Target Name: hykk. Target Synonyms: agphd1. Accession Number: A8WFT6. Expression Region: 1~355aa. Tag Info: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 60.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 60.5kDa
Tag: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: MSTKESKPNLSHSQVTDVVKRLYGLTASVVRPLPSYDDQNFYVAPSEGGEFVLKVMNSADSENVAVIELQTQSMNFLHQRGLPAQTALPTLTGQLMSLEEFDCGFGTQIYLVRLLTYLPGTTIAKITCSPQILYDVGKMAATLDTVLLQMEHPNTRVLQRERFIWKLTSIPLLNQYVHVMDGDPVQKIVKGVIEKYQVQVMPKLPLFRECINHGDFNDHNLLVKPDGPSKYKISGILDFADMSCGYFIFELAITI
Target-Kategorie: hykk