Recombinant E. coli Type 1 fimbrin D-mannose specific adhesin (fimH), Unconjugated

Artikelnummer: BIM-RPC25688
Artikelname: Recombinant E. coli Type 1 fimbrin D-mannose specific adhesin (fimH), Unconjugated
Artikelnummer: BIM-RPC25688
Hersteller Artikelnummer: RPC25688
Alternativnummer: BIM-RPC25688-20UG,BIM-RPC25688-100UG,BIM-RPC25688-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: E. coli
Konjugation: Unconjugated
Alternative Synonym: fimH, b4320, JW4283Type 1 fimbrin D-mannose specific adhesin, Protein FimH
Recombinant E. coli Type 1 fimbrin D-mannose specific adhesin (fimH) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: E. coli (strain K12). Target Name: fimH. Target Synonyms: fimH, b4320, JW4283Type 1 fimbrin D-mannose specific adhesin, Protein FimH. Accession Number: P08191. Expression Region: 22~300aa. Tag Info: C-Terminal 6Xhis-Tagged. Theoretical MW: 29.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 29.8kDa
Tag: C-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPTGGCDVSARDVTVTLPDYPGSVPIPLTVYCAKSQNLGYYLSGTTADAGNSIFTNTASFSPAQGVGVQLTRNGTIIPANNTVSLGAVGTSAVSLGLTAN
Target-Kategorie: fimH