Recombinant Rat Oncostatin-M (Osm), Unconjugated, Yeast

Artikelnummer: BIM-RPC25685
Artikelname: Recombinant Rat Oncostatin-M (Osm), Unconjugated, Yeast
Artikelnummer: BIM-RPC25685
Hersteller Artikelnummer: RPC25685
Alternativnummer: BIM-RPC25685-20UG,BIM-RPC25685-100UG,BIM-RPC25685-1MG
Hersteller: Biomatik Corporation
Wirt: Yeast
Kategorie: Proteine/Peptide
Spezies Reaktivität: Rat
Konjugation: Unconjugated
Alternative Synonym: Osm, Oncostatin-M, OSM
Recombinant Rat Oncostatin-M (Osm) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Rat (Rattus norvegicus). Target Name: Osm. Target Synonyms: Osm, Oncostatin-M, OSM. Accession Number: Q65Z15. Expression Region: 26~208aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 22.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 22.6kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: KRGCSSSSPKLLSQLKSQANITGNTASLLEPYILHQNLNTLTLRAACTEHPVAFPSEDMLRQLSKPDFLSTVHATLGRVWHQLGAFRQQFPKIQDFPELERARQNIQGIRNNVYCMARLLHPPLEIPEPTQADSGTSRPTTTAPGIFQIKIDSCRFLWGYHRFMGSVGRVFEEWGDGSRRSRR
Target-Kategorie: Osm