Recombinant Lolium perenne Pollen allergen Lol p 1, Unconjugated, E. coli

Artikelnummer: BIM-RPC25682
Artikelname: Recombinant Lolium perenne Pollen allergen Lol p 1, Unconjugated, E. coli
Artikelnummer: BIM-RPC25682
Hersteller Artikelnummer: RPC25682
Alternativnummer: BIM-RPC25682-20UG,BIM-RPC25682-100UG,BIM-RPC25682-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Plant
Konjugation: Unconjugated
Alternative Synonym: Allergen Lol p I (Allergen R7, Allergen: Lol p 1)
Recombinant Lolium perenne Pollen allergen Lol p 1 is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Lolium perenne (Perennial ryegrass). Target Name: Lolium perenne Pollen allergen Lol p 1. Target Synonyms: Allergen Lol p I (Allergen R7, Allergen: Lol p 1). Accession Number: P14946. Expression Region: 24~263aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 31.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 31.2kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: IAKVPPGPNITAEYGDKWLDAKSTWYGKPTGAGPKDNGGACGYKNVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNEEPIAPYHFDLSGHAFGSMAKKGEEQNVRSAGELELQFRRVKCKYPDDTKPTFHVEKASNPNYLAILVKYVDGDGDVVAVDIKEKGKDKWIELKESWGAVWRIDTPDKLTGPFTVRYTTEGGTKSEFEDVIPEGWKADTSYSAK
Target-Kategorie: Lolium perenne Pollen allergen Lol p 1