Recombinant Human Glutathione S-transferase P (GSTP1), Unconjugated, Yeast

Artikelnummer: BIM-RPC25658
Artikelname: Recombinant Human Glutathione S-transferase P (GSTP1), Unconjugated, Yeast
Artikelnummer: BIM-RPC25658
Hersteller Artikelnummer: RPC25658
Alternativnummer: BIM-RPC25658-20UG,BIM-RPC25658-100UG,BIM-RPC25658-1MG
Hersteller: Biomatik Corporation
Wirt: Yeast
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: GST class-piGSTP1-1
Recombinant Human Glutathione S-transferase P (GSTP1) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: GSTP1. Target Synonyms: GST class-piGSTP1-1. Accession Number: P09211. Expression Region: 2~210aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 25.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 25.2kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: PPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
Target-Kategorie: GSTP1