Recombinant Mouse Group XV phospholipase A2 (Pla2g15), Unconjugated, E. coli

Artikelnummer: BIM-RPC25613
Artikelname: Recombinant Mouse Group XV phospholipase A2 (Pla2g15), Unconjugated, E. coli
Artikelnummer: BIM-RPC25613
Hersteller Artikelnummer: RPC25613
Alternativnummer: BIM-RPC25613-20UG,BIM-RPC25613-100UG,BIM-RPC25613-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Mouse
Konjugation: Unconjugated
Alternative Synonym: 1-O-acylceramide synthase1ACSLCAT-like lysophospholipaseLLPLLysophospholipase 3Lysosomal phospholipase A22LPLA2
Recombinant Mouse Group XV phospholipase A2 (Pla2g15) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Pla2g15. Target Synonyms: 1-O-acylceramide synthase1ACSLCAT-like lysophospholipaseLLPLLysophospholipase 3Lysosomal phospholipase A22LPLA2. Accession Number: Q8VEB4. Expression Region: 34~412aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 50.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 50.5kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: AQRHPPVVLVPGDLGNQLEAKLDKPKVVHYLCSKKTDSYFTLWLNLELLLPVIIDCWIDNIRLVYNRTSRATQFPDGVDVRVPGFGETFSMEFLDPSKRNVGSYFYTMVESLVGWGYTRGEDVRGAPYDWRRAPNENGPYFLALREMIEEMYQMYGGPVVLVAHSMGNVYMLYFLQRQPQVWKDKYIHAFVSLGAPWGGVAKTLRVLASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNHTWSHEKVFVYTPTT
Target-Kategorie: Pla2g15