Recombinant Arabidopsis thaliana UDP-glycosyltransferase 89C1 (UGT89C1), Unconjugated, Yeast

Artikelnummer: BIM-RPC25611
Artikelname: Recombinant Arabidopsis thaliana UDP-glycosyltransferase 89C1 (UGT89C1), Unconjugated, Yeast
Artikelnummer: BIM-RPC25611
Hersteller Artikelnummer: RPC25611
Alternativnummer: BIM-RPC25611-20UG,BIM-RPC25611-100UG,BIM-RPC25611-1MG
Hersteller: Biomatik Corporation
Wirt: Yeast
Kategorie: Proteine/Peptide
Spezies Reaktivität: A. thaliana
Konjugation: Unconjugated
Alternative Synonym: Flavonol 7-O-rhamnosyltransferaseUDP-rhamnose: flavonol 7-O-rhamnosyltransferase
Recombinant Arabidopsis thaliana UDP-glycosyltransferase 89C1 (UGT89C1) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Arabidopsis thaliana (Mouse-ear cress). Target Name: UGT89C1. Target Synonyms: Flavonol 7-O-rhamnosyltransferaseUDP-rhamnose: flavonol 7-O-rhamnosyltransferase. Accession Number: Q9LNE6. Expression Region: 1~435aa. Tag Info: N-Terminal 10Xhis-Tagged. Theoretical MW: 50.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 50.6kDa
Tag: N-Terminal 10Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: MTTTTTKKPHVLVIPFPQSGHMVPHLDLTHQILLRGATVTVLVTPKNSSYLDALRSLHSPEHFKTLILPFPSHPCIPSGVESLQQLPLEAIVHMFDALSRLHDPLVDFLSRQPPSDLPDAILGSSFLSPWINKVADAFSIKSISFLPINAHSISVMWAQEDRSFFNDLETATTESYGLVINSFYDLEPEFVETVKTRFLNHHRIWTVGPLLPFKAGVDRGGQSSIPPAKVSAWLDSCPEDNSVVYVGFGSQIRLT
Target-Kategorie: UGT89C1