Recombinant Viscum album Beta-galactoside-specific lectin 1, Unconjugated, Yeast

Artikelnummer: BIM-RPC25609
Artikelname: Recombinant Viscum album Beta-galactoside-specific lectin 1, Unconjugated, Yeast
Artikelnummer: BIM-RPC25609
Hersteller Artikelnummer: RPC25609
Alternativnummer: BIM-RPC25609-20UG,BIM-RPC25609-100UG,BIM-RPC25609-1MG
Hersteller: Biomatik Corporation
Wirt: Yeast
Kategorie: Proteine/Peptide
Spezies Reaktivität: Plant
Konjugation: Unconjugated
Alternative Synonym: Beta-galactoside-specific lectin IViscumin
Recombinant Viscum album Beta-galactoside-specific lectin 1 is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Viscum album (European mistletoe). Target Name: Viscum album Beta-galactoside-specific lectin 1. Target Synonyms: Beta-galactoside-specific lectin IViscumin. Accession Number: P81446. Expression Region: 34~287aa. Tag Info: N-Terminal 6Xhis-Sumostar-Tagged. Theoretical MW: 44.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 44.4kDa
Tag: N-Terminal 6Xhis-Sumostar-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: YERLRLRVTHQTTGEEYFRFITLLRDYVSSGSFSNEIPLLRQSTIPVSDAQRFVLVELTNEGGDSITAAIDVTNLYVVAYQAGDQSYFLRDAPRGAETHLFTGTTRSSLPFNGSYPDLERYAGHRDQIPLGIDQLIQSVTALRFPGGSTRTQARSILILIQMISEAARFNPILWRARQYINSGASFLPDVYMLELETSWGQQSTQVQQSTDGVFNNPIRLAIPPGNFVTLTNVRDVIASLAIMLFVCGERPSSS
Target-Kategorie: Viscum album Beta-galactoside-specific lectin 1