Recombinant Human CD63 antigen (CD63), partial, Unconjugated, Yeast

Artikelnummer: BIM-RPC25605
Artikelname: Recombinant Human CD63 antigen (CD63), partial, Unconjugated, Yeast
Artikelnummer: BIM-RPC25605
Hersteller Artikelnummer: RPC25605
Alternativnummer: BIM-RPC25605-20UG,BIM-RPC25605-100UG,BIM-RPC25605-1MG
Hersteller: Biomatik Corporation
Wirt: Yeast
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: GranulophysinLysosomal-associated membrane protein 3LAMP-3Melanoma-associated antigen ME491OMA81HOcular melanoma-associated antigenTetraspanin-30Tspan-30CD_antigen: CD63MLA1, TSPAN30
Recombinant Human CD63 antigen (CD63), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: CD63. Target Synonyms: GranulophysinLysosomal-associated membrane protein 3LAMP-3Melanoma-associated antigen ME491OMA81HOcular melanoma-associated antigenTetraspanin-30Tspan-30CD_antigen: CD63MLA1, TSPAN30. Accession Number: P08962. Expression Region: 103~203aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 13.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 13.5kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: AGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNV
Target-Kategorie: CD63