Recombinant Human L-lactate dehydrogenase A chain (LDHA), partial, Unconjugated, E. coli

Artikelnummer: BIM-RPC25603
Artikelname: Recombinant Human L-lactate dehydrogenase A chain (LDHA), partial, Unconjugated, E. coli
Artikelnummer: BIM-RPC25603
Hersteller Artikelnummer: RPC25603
Alternativnummer: BIM-RPC25603-20UG,BIM-RPC25603-100UG,BIM-RPC25603-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Cell proliferation-inducing gene 19 proteinLDH muscle subunit
Recombinant Human L-lactate dehydrogenase A chain (LDHA), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: LDHA. Target Synonyms: Cell proliferation-inducing gene 19 proteinLDH muscle subunit. Accession Number: P00338. Expression Region: 5~323aa. Tag Info: Tag-Free. Theoretical MW: 35.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 35.1kDa
Tag: Tag-Free
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: KDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADL
Target-Kategorie: LDHA