Recombinant chicken Interleukin-8 (CXCL8), partial, Unconjugated, E. coli

Artikelnummer: BIM-RPC25601
Artikelname: Recombinant chicken Interleukin-8 (CXCL8), partial, Unconjugated, E. coli
Artikelnummer: BIM-RPC25601
Hersteller Artikelnummer: RPC25601
Alternativnummer: BIM-RPC25601-20UG,BIM-RPC25601-100UG,BIM-RPC25601-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Gallus
Konjugation: Unconjugated
Alternative Synonym: 9E3C-X-C motif chemokine 8CEF-4Chemokine (C-X-C motif) ligand 8Embryo fibroblast protein 1
Recombinant chicken Interleukin-8 (CXCL8), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Chicken (Gallus). Target Name: CXCL8. Target Synonyms: 9E3C-X-C motif chemokine 8CEF-4Chemokine (C-X-C motif) ligand 8Embryo fibroblast protein 1. Accession Number: P08317. Expression Region: 17~102aa. Tag Info: Tag-Free. Theoretical MW: 9.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 9.4kDa
Tag: Tag-Free
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: ALSQGRTLVKMGNELRCQCISTHSKFIHPKSIQDVKLTPSGPHCKNVEIIATLKDGREVCLDPTAPWVQLIVKALMAKAQLNSDAP
Target-Kategorie: CXCL8