Recombinant human Multiple inositol polyphosphate phosphatase 1 (MINPP1), Unconjugated, Yeast

Artikelnummer: BIM-RPC25569
Artikelname: Recombinant human Multiple inositol polyphosphate phosphatase 1 (MINPP1), Unconjugated, Yeast
Artikelnummer: BIM-RPC25569
Hersteller Artikelnummer: RPC25569
Alternativnummer: BIM-RPC25569-20UG,BIM-RPC25569-100UG,BIM-RPC25569-1MG
Hersteller: Biomatik Corporation
Wirt: Yeast
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: 2,3-bisphosphoglycerate 3-phosphatase (EC:3.1.3.80), 2,3-BPG phosphataseInositol (1,3,4,5)-tetrakisphosphate 3-phosphatase, Ins(1,3,4,5)P(4) 3-phosphatase
Recombinant human Multiple inositol polyphosphate phosphatase 1 (MINPP1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: MINPP1. Target Synonyms: 2,3-bisphosphoglycerate 3-phosphatase (EC:3.1.3.80), 2,3-BPG phosphataseInositol (1,3,4,5)-tetrakisphosphate 3-phosphatase, Ins(1,3,4,5)P(4) 3-phosphatase. Accession Number: Q9UNW1. Expression Region: 31~487aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 54.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 54.1kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: SLLEPRDPVASSLSPYFGTKTRYEDVNPVLLSGPEAPWRDPELLEGTCTPVQLVALIRHGTRYPTVKQIRKLRQLHGLLQARGSRDGGASSTGSRDLGAALADWPLWYADWMDGQLVEKGRQDMRQLALRLASLFPALFSRENYGRLRLITSSKHRCMDSSAAFLQGLWQHYHPGLPPPDVADMEFGPPTVNDKLMRFFDHCEKFLTEVEKNATALYHVEAFKTGPEMQNILKKVAATLQVPVNDLNADLIQVAF
Target-Kategorie: MINPP1