Recombinant Human Secreted Ly-6/uPAR domain-containing protein 2 (SLURP2), Unconjugated, Yeast

Artikelnummer: BIM-RPC25512
Artikelname: Recombinant Human Secreted Ly-6/uPAR domain-containing protein 2 (SLURP2), Unconjugated, Yeast
Artikelnummer: BIM-RPC25512
Hersteller Artikelnummer: RPC25512
Alternativnummer: BIM-RPC25512-20UG,BIM-RPC25512-100UG,BIM-RPC25512-1MG
Hersteller: Biomatik Corporation
Wirt: Yeast
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Secreted LY6/PLAUR domain-containing protein 2Secreted Ly-6/uPAR-related protein 2
Recombinant Human Secreted Ly-6/uPAR domain-containing protein 2 (SLURP2) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: SLURP2. Target Synonyms: Secreted LY6/PLAUR domain-containing protein 2Secreted Ly-6/uPAR-related protein 2. Accession Number: P0DP57. Expression Region: 23~97aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 10kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 10kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: IWCHQCTGFGGCSHGSRCLRDSTHCVTTATRVLSNTEDLPLVTKMCHIGCPDIPSLGLGPYVSIACCQTSLCNHD
Target-Kategorie: SLURP2