Recombinant Human Protein S100-A7A (S100A7A), partial, Unconjugated, Yeast

Artikelnummer: BIM-RPC25441
Artikelname: Recombinant Human Protein S100-A7A (S100A7A), partial, Unconjugated, Yeast
Artikelnummer: BIM-RPC25441
Hersteller Artikelnummer: RPC25441
Alternativnummer: BIM-RPC25441-20UG,BIM-RPC25441-100UG,BIM-RPC25441-1MG
Hersteller: Biomatik Corporation
Wirt: Yeast
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: S100 calcium-binding protein A15S100 calcium-binding protein A7-like 1S100 calcium-binding protein A7A
Recombinant Human Protein S100-A7A (S100A7A), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: S100A7A. Target Synonyms: S100 calcium-binding protein A15S100 calcium-binding protein A7-like 1S100 calcium-binding protein A7A. Accession Number: Q86SG5. Expression Region: 2~101aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 13.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 13.2kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: SNTQAERSIIGMIDMFHKYTGRDGKIEKPSLLTMMKENFPNFLSACDKKGIHYLATVFEKKDKNEDKKIDFSEFLSLLGDIAADYHKQSHGAAPCSGGSQ
Target-Kategorie: S100A7A