Recombinant Human Cementoblastoma-derived protein 1 (CEMP1), Unconjugated, Yeast

Artikelnummer: BIM-RPC25435
Artikelname: Recombinant Human Cementoblastoma-derived protein 1 (CEMP1), Unconjugated, Yeast
Artikelnummer: BIM-RPC25435
Hersteller Artikelnummer: RPC25435
Alternativnummer: BIM-RPC25435-20UG,BIM-RPC25435-100UG,BIM-RPC25435-1MG
Hersteller: Biomatik Corporation
Wirt: Yeast
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Cementum protein 1Cementum protein 23, CP-23
Recombinant Human Cementoblastoma-derived protein 1 (CEMP1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: CEMP1. Target Synonyms: Cementum protein 1Cementum protein 23, CP-23. Accession Number: Q6PRD7. Expression Region: 1~247aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 28kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 28kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: MGTSSTDSQQAGHRRCSTSNTSAENLTCLSLPGSPGKTAPLPGPAQAGAGQPLPKGCAAVKAEVGIPAPHTSQEVRIHIRRLLSWAAPGACGLRSTPCALPQALPQARPCPGRWFFPGCSLPTGGAQTILSLWTWRHFLNWALQQREENSGRARRVPPVPRTAPVSKGEGSHPPQNSNGEKVKTITPDVGLHQSLTSDPTVAVLRAKRAPEAHPPRSCSGSLTARVCHMGVCQGQGDTEDGRMTLMG
Target-Kategorie: CEMP1