Recombinant Danio rerio COP9 signalosome complex subunit 2 (cops2), Unconjugated, Yeast

Artikelnummer: BIM-RPC25427
Artikelname: Recombinant Danio rerio COP9 signalosome complex subunit 2 (cops2), Unconjugated, Yeast
Artikelnummer: BIM-RPC25427
Hersteller Artikelnummer: RPC25427
Alternativnummer: BIM-RPC25427-20UG,BIM-RPC25427-100UG,BIM-RPC25427-1MG
Hersteller: Biomatik Corporation
Wirt: Yeast
Kategorie: Proteine/Peptide
Spezies Reaktivität: Zebrafish
Konjugation: Unconjugated
Alternative Synonym: csn2
Recombinant Danio rerio COP9 signalosome complex subunit 2 (cops2) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Danio rerio (Zebrafish) (Brachydanio rerio). Target Name: cops2. Target Synonyms: csn2. Accession Number: Q6IQT4. Expression Region: 1~443aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 53.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 53.6kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: MSDMEDDFMCDDEEDYDLEYSEDSNSEPNVDLENQYYNSKALKEDDPKAALSSFQKVLELEGEKGEWGFKALKQMIKINFKLTNFPEMMNRYKQLLTYIRSAVTRNYSEKSINSILDYISTSKQMDLLQEFYETTLEALKDAKNDRLWFKTNTKLGKLYLEREEFGKLQKILRQLHQSCQTDDGEDDLKKGTQLLEIYALEIQMYTAQKNNKKLKALYEQSLHIKSAIPHPLIMGVIRECGGKMHLREGEFEKAH
Target-Kategorie: cops2