Recombinant Mouse NAD (P)H dehydrogenase [quinone] 1 (Nqo1), Unconjugated, Yeast

Artikelnummer: BIM-RPC25406
Artikelname: Recombinant Mouse NAD (P)H dehydrogenase [quinone] 1 (Nqo1), Unconjugated, Yeast
Artikelnummer: BIM-RPC25406
Hersteller Artikelnummer: RPC25406
Alternativnummer: BIM-RPC25406-20UG,BIM-RPC25406-100UG,BIM-RPC25406-1MG
Hersteller: Biomatik Corporation
Wirt: Yeast
Kategorie: Proteine/Peptide
Spezies Reaktivität: Mouse
Konjugation: Unconjugated
Alternative Synonym: AzoreductaseDT-diaphoraseDTDMenadione reductaseNAD(P)H:quinone oxidoreductase 1Phylloquinone reductaseQuinone reductase 1QR1
Recombinant Mouse NAD (P)H dehydrogenase [quinone] 1 (Nqo1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Nqo1. Target Synonyms: AzoreductaseDT-diaphoraseDTDMenadione reductaseNAD(P)H:quinone oxidoreductase 1Phylloquinone reductaseQuinone reductase 1QR1. Accession Number: Q64669. Expression Region: 2~274aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 32.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 32.8kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: AARRALIVLAHSEKTSFNYAMKEAAVEALKKRGWEVLESDLYAMNFNPIISRNDITGELKDSKNFQYPSESSLAYKEGRLSPDIVAEHKKLEAADLVIFQFPLQWFGVPAILKGWFERVLVAGFAYTYAAMYDNGPFQNKKTLLSITTGGSGSMYSLQGVHGDMNVILWPIQSGILRFCGFQVLEPQLVYSIGHTPPDARMQILEGWKKRLETVWEETPLYFAPSSLFDLNFQAGFLMKKEVQEEQKKNKFGLSV
Target-Kategorie: Nqo1