Recombinant Human Glucokinase regulatory protein (GCKR), Unconjugated, Yeast

Artikelnummer: BIM-RPC25369
Artikelname: Recombinant Human Glucokinase regulatory protein (GCKR), Unconjugated, Yeast
Artikelnummer: BIM-RPC25369
Hersteller Artikelnummer: RPC25369
Alternativnummer: BIM-RPC25369-20UG,BIM-RPC25369-100UG,BIM-RPC25369-1MG
Hersteller: Biomatik Corporation
Wirt: Yeast
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: FGQTL5, GCK, GCKR, GCKR_HUMAN, GKRP, GLRE, glucokinase (hexokinase 4) regulator, Glucokinase, Glucokinase regulator, Glucokinase regulatory protein, Hexokinase 4 regulator, Hexokinase type IV, Hexokinase-4, Hexokinase-D, HK IV, HK4, OTTHUMP00000158533
Recombinant Human Glucokinase regulatory protein (GCKR) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: GCKR. Target Synonyms: FGQTL5, GCK, GCKR, GCKR_HUMAN, GKRP, GLRE, glucokinase (hexokinase 4) regulator, Glucokinase, Glucokinase regulator, Glucokinase regulatory protein, Hexokinase 4 regulator, Hexokinase type IV, Hexokinase-4, Hexokinase-D, HK IV, HK4, OTTHUMP00000158533. Accession Number: Q14397. Expression Region: 1~625aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 70.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 70.7kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: MPGTKRFQHVIETPEPGKWELSGYEAAVPITEKSNPLTQDLDKADAENIVRLLGQCDAEIFQEEGQALSTYQRLYSESILTTMVQVAGKVQEVLKEPDGGLVVLSGGGTSGRMAFLMSVSFNQLMKGLGQKPLYTYLIAGGDRSVVASREGTEDSALHGIEELKKVAAGKKRVIVIGISVGLSAPFVAGQMDCCMNNTAVFLPVLVGFNPVSMARNDPIEDWSSTFRQVAERMQKMQEKQKAFVLNPAIGPEGLS
Target-Kategorie: GCKR