Recombinant Human Reticulocalbin-1 (RCN1), partial, Unconjugated, Yeast

Artikelnummer: BIM-RPC25362
Artikelname: Recombinant Human Reticulocalbin-1 (RCN1), partial, Unconjugated, Yeast
Artikelnummer: BIM-RPC25362
Hersteller Artikelnummer: RPC25362
Alternativnummer: BIM-RPC25362-20UG,BIM-RPC25362-100UG,BIM-RPC25362-1MG
Hersteller: Biomatik Corporation
Wirt: Yeast
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Epididymis secretory protein Li 84, FLJ37041, HEL S 84, PIG20, Proliferation inducing gene 20, RCAL, RCN 1, RCN, rcn1, RCN1_HUMAN, Reticulocalbin 1, Reticulocalbin 1 EF hand calcium binding domain, Reticulocalbin-1, Reticulocalbin1
Recombinant Human Reticulocalbin-1 (RCN1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: RCN1. Target Synonyms: Epididymis secretory protein Li 84, FLJ37041, HEL S 84, PIG20, Proliferation inducing gene 20, RCAL, RCN 1, RCN, rcn1, RCN1_HUMAN, Reticulocalbin 1, Reticulocalbin 1 EF hand calcium binding domain, Reticulocalbin-1, Reticulocalbin1. Accession Number: Q15293. Expression Region: 31~331aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 37.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 37.7kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: PTVRKERVVRPDSELGERPPEDNQSFQYDHEAFLGKEDSKTFDQLTPDESKERLGKIVDRIDNDGDGFVTTEELKTWIKRVQKRYIFDNVAKVWKDYDRDKDDKISWEEYKQATYGYYLGNPAEFHDSSDHHTFKKMLPRDERRFKAADLNGDLTATREEFTAFLHPEEFEHMKEIVVLETLEDIDKNGDGFVDQDEYIADMFSHEENGPEPDWVLSEREQFNEFRDLNKDGKLDKDEIRHWILPQDYDHAQAEA
Target-Kategorie: RCN1