Recombinant Human Podocalyxin protein (PODXL), partial, Unconjugated, Yeast

Artikelnummer: BIM-RPC25321
Artikelname: Recombinant Human Podocalyxin protein (PODXL), partial, Unconjugated, Yeast
Artikelnummer: BIM-RPC25321
Hersteller Artikelnummer: RPC25321
Alternativnummer: BIM-RPC25321-20UG,BIM-RPC25321-100UG,BIM-RPC25321-1MG
Hersteller: Biomatik Corporation
Wirt: Yeast
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: GCTM-2 antigen, Gp200Podocalyxin-like protein 1, PC, PCLP-1
Recombinant Human Podocalyxin protein (PODXL), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: PODXL. Target Synonyms: GCTM-2 antigen, Gp200Podocalyxin-like protein 1, PC, PCLP-1. Accession Number: O00592. Expression Region: 32~458aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 46.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 46.2kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: QNATQTTTDSSNKTAPTPASSVTIMATDTAQQSTVPTSKANEILASVKATTLGVSSDSPGTTTLAQQVSGPVNTTVARGGGSGNPTTTIESPKSTKSADTTTVATSTATAKPNTTSSQNGAEDTTNSGGKSSHSVTTDLTSTKAEHLTTPHPTSPLSPRQPTSTHPVATPTSSGHDHLMKISSSSSTVAIPGYTFTSPGMTTTLLETVFHHVSQAGLELLTSGDLPTLASQSAGITASSVISQRTQQTSSQMPAS
Target-Kategorie: PODXL