Recombinant Enterobacteria phage T7 Single-stranded DNA-binding protein gp2.5 (2.5), Unconjugated, Yeast

Artikelnummer: BIM-RPC25294
Artikelname: Recombinant Enterobacteria phage T7 Single-stranded DNA-binding protein gp2.5 (2.5), Unconjugated, Yeast
Artikelnummer: BIM-RPC25294
Hersteller Artikelnummer: RPC25294
Alternativnummer: BIM-RPC25294-20UG,BIM-RPC25294-100UG,BIM-RPC25294-1MG
Hersteller: Biomatik Corporation
Wirt: Yeast
Kategorie: Proteine/Peptide
Spezies Reaktivität: Bacteria
Konjugation: Unconjugated
Alternative Synonym: 2.5Single-stranded DNA-binding protein gp2.5, SSB protein
Recombinant Enterobacteria phage T7 Single-stranded DNA-binding protein gp2.5 (2.5) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Enterobacteria phage T7 (Bacteriophage T7). Target Name: 2.5. Target Synonyms: 2.5Single-stranded DNA-binding protein gp2.5, SSB protein. Accession Number: P03696. Expression Region: 1~232aa. Tag Info: Tag-Free. Theoretical MW: 25.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 25.7kDa
Tag: Tag-Free
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: MAKKIFTSALGTAEPYAYIAKPDYGNEERGFGNPRGVYKVDLTIPNKDPRCQRMVDEIVKCHEEAYAAAVEEYEANPPAVARGKKPLKPYEGDMPFFDNGDGTTTFKFKCYASFQDKKTKETKHINLVVVDSKGKKMEDVPIIGGGSKLKVKYSLVPYKWNTAVGASVKLQLESVMLVELATFGGGEDDWADEVEENGYVASGSAKASKPRDEESWDEDDEESEEADEDGDF
Target-Kategorie: 2.5