Recombinant Human papillomavirus type 16 Protein E6 (E6), Unconjugated, Yeast

Artikelnummer: BIM-RPC25291
Artikelname: Recombinant Human papillomavirus type 16 Protein E6 (E6), Unconjugated, Yeast
Artikelnummer: BIM-RPC25291
Hersteller Artikelnummer: RPC25291
Alternativnummer: BIM-RPC25291-20UG,BIM-RPC25291-100UG,BIM-RPC25291-1MG
Hersteller: Biomatik Corporation
Wirt: Yeast
Kategorie: Proteine/Peptide
Spezies Reaktivität: Virus
Konjugation: Unconjugated
Alternative Synonym: E6, Protein E6
Recombinant Human papillomavirus type 16 Protein E6 (E6) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human papillomavirus type 16. Target Name: E6. Target Synonyms: E6, Protein E6. Accession Number: P03126. Expression Region: 1~158aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 21.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 21.2kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: MHQKRTAMFQDPQERPRKLPQLCTELQTTIHDIILECVYCKQQLLRREVYDFAFRDLCIVYRDGNPYAVCDKCLKFYSKISEYRHYCYSLYGTTLEQQYNKPLCDLLIRCINCQKPLCPEEKQRHLDKKQRFHNIRGRWTGRCMSCCRSSRTRRETQL
Target-Kategorie: E6