Recombinant Bacillus thuringiensis subsp. kurstaki Pesticidal crystal protein Cry1Ab (cry1Ab), partial, Unconjugated, Yeast

Artikelnummer: BIM-RPC25279
Artikelname: Recombinant Bacillus thuringiensis subsp. kurstaki Pesticidal crystal protein Cry1Ab (cry1Ab), partial, Unconjugated, Yeast
Artikelnummer: BIM-RPC25279
Hersteller Artikelnummer: RPC25279
Alternativnummer: BIM-RPC25279-20UG,BIM-RPC25279-100UG,BIM-RPC25279-1MG
Hersteller: Biomatik Corporation
Wirt: Yeast
Kategorie: Proteine/Peptide
Spezies Reaktivität: Bacteria
Konjugation: Unconjugated
Alternative Synonym: 130 kDa crystal protein, Crystaline entomocidal protoxinInsecticidal delta-endotoxin CryIA(b)
Recombinant Bacillus thuringiensis subsp. kurstaki Pesticidal crystal protein Cry1Ab (cry1Ab), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Bacillus thuringiensis subsp. kurstaki. Target Name: cry1Ab. Target Synonyms: 130 kDa crystal protein, Crystaline entomocidal protoxinInsecticidal delta-endotoxin CryIA(b). Accession Number: P0A370. Expression Region: 1022~1155aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 17.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 17.3kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: HEIENNTDELKFSNCVEEEVYPNNTVTCNDYTATQEEYEGTYTSRNRGYDGAYESNSSVPADYASAYEEKAYTDGRRDNPCESNRGYGDYTPLPAGYVTKELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE
Target-Kategorie: cry1Ab