Recombinant Bovine Odorant-binding protein, Unconjugated, Yeast

Artikelnummer: BIM-RPC25272
Artikelname: Recombinant Bovine Odorant-binding protein, Unconjugated, Yeast
Artikelnummer: BIM-RPC25272
Hersteller Artikelnummer: RPC25272
Alternativnummer: BIM-RPC25272-20UG,BIM-RPC25272-100UG,BIM-RPC25272-1MG
Hersteller: Biomatik Corporation
Wirt: Yeast
Kategorie: Proteine/Peptide
Spezies Reaktivität: Bovine
Konjugation: Unconjugated
Alternative Synonym: Olfactory mucosa pyrazine-binding protein
Recombinant Bovine Odorant-binding protein is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Bovine (Bos taurus). Target Name: Bovine Odorant-binding protein. Target Synonyms: Olfactory mucosa pyrazine-binding protein. Accession Number: P07435. Expression Region: 1~159aa. Tag Info: N-Terminal 6Xhis-Sumostar-Tagged. Theoretical MW: 34.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 34.5kDa
Tag: N-Terminal 6Xhis-Sumostar-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: AQEEEAEQNLSELSGPWRTVYIGSTNPEKIQENGPFRTYFRELVFDDEKGTVDFYFSVKRDGKWKNVHVKATKQDDGTYVADYEGQNVFKIVSLSRTHLVAHNINVDKHGQTTELTELFVKLNVEDEDLEKFWKLTEDKGIDKKNVVNFLENEDHPHPE
Target-Kategorie: Bovine Odorant-binding protein