Recombinant Human Interferon alpha-2 (IFNA2), Unconjugated, Yeast

Artikelnummer: BIM-RPC25254
Artikelname: Recombinant Human Interferon alpha-2 (IFNA2), Unconjugated, Yeast
Artikelnummer: BIM-RPC25254
Hersteller Artikelnummer: RPC25254
Alternativnummer: BIM-RPC25254-20UG,BIM-RPC25254-100UG,BIM-RPC25254-1MG
Hersteller: Biomatik Corporation
Wirt: Yeast
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Interferon alpha-A, LeIF A
Recombinant Human Interferon alpha-2 (IFNA2) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: IFNA2. Target Synonyms: Interferon alpha-A, LeIF A. Accession Number: P01563. Expression Region: 24~188aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 21.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 21.2kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
Target-Kategorie: IFNA2