Recombinant Rabies virus Matrix protein (M), Unconjugated, E. coli

Artikelnummer: BIM-RPC22543
Artikelname: Recombinant Rabies virus Matrix protein (M), Unconjugated, E. coli
Artikelnummer: BIM-RPC22543
Hersteller Artikelnummer: RPC22543
Alternativnummer: BIM-RPC22543-20UG,BIM-RPC22543-100UG,BIM-RPC22543-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Rabies virus
Konjugation: Unconjugated
Alternative Synonym: Phosphoprotein M2
Recombinant Rabies virus Matrix protein (M) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Rabies virus (strain CVS-11) (RABV). Target Name: M. Target Synonyms: Phosphoprotein M2. Accession Number: P25223. Expression Region: 1~202aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 28.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 28.1kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: MNVLRKIVKKCRDEDTQKPSPVSAPPYDDDLWLPPPEYVPLKELTSKKNMRNFCVNGEVKACSPNGYSFRILRHILGSFNEIYSGNHRMIGLVKVVVGLALSGAPVPEGMNWVYKLRRTLIFQWADSRGPLEGEELEYSQEITWDDDTEFVGLQIRVGARQCHIQGRIWCINSNSRACQLWSDMSLQTQRSEEDKDSSLLLE
Target-Kategorie: M