Recombinant Salmonella typhimurium Protein PrgJ (PrgJ), Unconjugated, E. coli

Artikelnummer: BIM-RPC22532
Artikelname: Recombinant Salmonella typhimurium Protein PrgJ (PrgJ), Unconjugated, E. coli
Artikelnummer: BIM-RPC22532
Hersteller Artikelnummer: RPC22532
Alternativnummer: BIM-RPC22532-20UG,BIM-RPC22532-100UG,BIM-RPC22532-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Bacteria
Konjugation: Unconjugated
Alternative Synonym: prgJ, STM2872Protein PrgJ
Recombinant Salmonella typhimurium Protein PrgJ (PrgJ) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720). Target Name: prgJ. Target Synonyms: prgJ, STM2872Protein PrgJ. Accession Number: P41785. Expression Region: 1~101aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 15.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 15.9kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: MSIATIVPENAVIGQAVNIRSMETDIVSLDDRLLQAFSGSAIATAVDKQTITNRIEDPNLVTDPKELAISQEMISDYNLYVSMVSTLTRKGVGAVETLLRS
Target-Kategorie: prgJ