Recombinant Staphylococcus aureus Leukocidin-F subunit (lukF), Unconjugated, E. coli

Artikelnummer: BIM-RPC22526
Artikelname: Recombinant Staphylococcus aureus Leukocidin-F subunit (lukF), Unconjugated, E. coli
Artikelnummer: BIM-RPC22526
Hersteller Artikelnummer: RPC22526
Alternativnummer: BIM-RPC22526-20UG,BIM-RPC22526-100UG,BIM-RPC22526-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Bacteria
Konjugation: Unconjugated
Alternative Synonym: Gamma-hemolysin, H-gamma-I subunit
Recombinant Staphylococcus aureus Leukocidin-F subunit (lukF) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Staphylococcus aureus. Target Name: lukF. Target Synonyms: Gamma-hemolysin, H-gamma-I subunit. Accession Number: P31715. Expression Region: 26~323aa. Tag Info: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 54kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 54kDa
Tag: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: AEGKITPVSVKKVDDKVTLYKTTATADSDKFKISQILTFNFIKDKSYDKDTLVLKATGNINSGFVKPNPNDYDFSKLYWGAKYNVSISSQSNDSVNAVDYAPKNQNEEFQVQNTLGYTFGGDISISNGLSGGLNGNTAFSETINYKQESYRTLSRNTNYKNVGWGVEAHKIMNGWGPYGRDSFHPTYGNELFLAGRQSSAYAGQNFIAQHQMPLLSRSNFNPEFLSVLSHRQDRAKKSKITVTYQREMDLYQIRW
Target-Kategorie: lukF