Recombinant Human Steroid 21-hydroxylase (CYP21A2), Unconjugated, E. coli

Artikelnummer: BIM-RPC20031
Artikelname: Recombinant Human Steroid 21-hydroxylase (CYP21A2), Unconjugated, E. coli
Artikelnummer: BIM-RPC20031
Hersteller Artikelnummer: RPC20031
Alternativnummer: BIM-RPC20031-20UG,BIM-RPC20031-100UG,BIM-RPC20031-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: 21-OHaseCytochrome P-450c21Cytochrome P450 21Cytochrome P450 XXICytochrome P450-C21Cytochrome P450-C21B
Recombinant Human Steroid 21-hydroxylase (CYP21A2) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: CYP21A2. Target Synonyms: 21-OHaseCytochrome P-450c21Cytochrome P450 21Cytochrome P450 XXICytochrome P450-C21Cytochrome P450-C21B. Accession Number: P08686. Expression Region: 1~494aaa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 59.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 59.9kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: MLLLGLLLLPLLAGARLLWNWWKLRSLHLPPLAPGFLHLLQPDLPIYLLGLTQKFGPIYRLHLGLQDVVVLNSKRTIEEAMVKKWADFAGRPEPLTYKLVSKNYPDLSLGDYSLLWKAHKKLTRSALLLGIRDSMEPVVEQLTQEFCERMRAQPGTPVAIEEEFSLLTCSIICYLTFGDKIKDDNLMPAYYKCIQEVLKTWSHWSIQIVDVIPFLRFFPNPGLRRLKQAIEKRDHIVEMQLRQHKESLVAGQWRD
Target-Kategorie: CYP21A2