Recombinant Human Aquaporin-4 (AQP4), partial, Unconjugated, E. coli

Artikelnummer: BIM-RPC20006
Artikelname: Recombinant Human Aquaporin-4 (AQP4), partial, Unconjugated, E. coli
Artikelnummer: BIM-RPC20006
Hersteller Artikelnummer: RPC20006
Alternativnummer: BIM-RPC20006-20UG,BIM-RPC20006-100UG,BIM-RPC20006-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Mercurial-insensitive water channel, MIWCWCH4
Recombinant Human Aquaporin-4 (AQP4), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: AQP4. Target Synonyms: Mercurial-insensitive water channel, MIWCWCH4. Accession Number: P55087. Expression Region: 253~323aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 24kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 24kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: CPDVEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQVETDDLILKPGVVHVIDVDRGEEKKGKDQSGEVLSSV
Target-Kategorie: AQP4