Anti-RTN1
Artikelnummer:
ATA-HPA044249
- Bilder (9)
| Artikelname: | Anti-RTN1 |
| Artikelnummer: | ATA-HPA044249 |
| Hersteller Artikelnummer: | HPA044249 |
| Alternativnummer: | ATA-HPA044249-100,ATA-HPA044249-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | NSP |
| reticulon 1 |
| Anti-RTN1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 6252 |
| UniProt: | Q16799 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | SITPPSSGTEPSAAESQGKGSISEDELITAIKEAKGLSYETAENPRPVGQLADRPEVKARSGPPTIPSPLDHEASSAESGDSEIELVS |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | RTN1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:2500 - 1:5000 |
|
|
Immunofluorescent staining of human cell line SiHa shows localization to endoplasmic reticulum. |
|
|
Immunohistochemistry analysis in human cerebral cortex and kidney tissues using HPA044249 antibody. Corresponding RTN1 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human cerebral cortex shows moderate to strong positivity in neurons. |
|
|
Immunohistochemical staining of human cervix, uterine shows moderate to strong cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human kidney shows moderate to strong cytoplasmic positivity in cells in tubules. |
|
|
HPA044249-100ul |
|
|
|
|
|
HPA044249-100ul |
|
|
HPA044249-100ul |
Produktgarantie und fachkundiger Support
